Loading...
Statistics
Advertisement

Webhosting und Webspace bei Alfahosting.de • Herzlich Willkommen auf ...
www.fitnessbroker.de/

Fitnessbroker.de

Advertisement
Conversion Technology Metas Server
Fitnessbroker.de is hosted in Germany . Fitnessbroker.de uses HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Fitnessbroker.de

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Fitnessbroker.de

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by Alfahosting GmbH/OU=PositiveSSL Wildcard/CN=*.alfahosting-server.de
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by Alfahosting GmbH
        • 2: PositiveSSL Wildcard
      • CN: *.alfahosting-server.de
    • hash: 106f7d13
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 162537403823597637267999238811244445824
    • validFrom: 151005000000Z
    • validTo: 170222235959Z
    • validFrom_time_t: 1444003200
    • validTo_time_t: 1487807999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 39:45:34:98:FB:80:C2:AC:57:D6:FB:ED:2D:FD:ED:C4:E2:65:4A:BC
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.alfahosting-server.de, DNS:alfahosting-server.de

Meta - Fitnessbroker.de

Number of occurences: 0

Server / Hosting

  • IP: 109.237.132.26
  • Latitude: 51.30
  • Longitude: 9.49
  • Country: Germany

Rname

  • cns3.alfahosting.info
  • cns1.alfahosting.info
  • cns2.alfahosting.info
  • mail.fitnessbroker.de

Target

  • hostmaster.alfahosting.de

HTTP Header Response

HTTP/1.1 200 OK Date: Sat, 10 Sep 2016 08:28:04 GMT Server: Apache Last-Modified: Sat, 10 Nov 2012 11:03:02 GMT Accept-Ranges: none Vary: Accept-Encoding Content-Length: 2698 Content-Type: text/html; charset=iso-8859-1 X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive

DNS

host: fitnessbroker.de
  1. class: IN
  2. ttl: 10800
  3. type: A
  4. ip: 109.237.132.26
host: fitnessbroker.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: cns3.alfahosting.info
host: fitnessbroker.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: cns1.alfahosting.info
host: fitnessbroker.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: cns2.alfahosting.info
host: fitnessbroker.de
  1. class: IN
  2. ttl: 10800
  3. type: SOA
  4. mname: cns1.alfahosting.info
  5. rname: hostmaster.alfahosting.de
  6. serial: 2015082401
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 10800
host: fitnessbroker.de
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: mail.fitnessbroker.de

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.itnessbroker.de, www.fqitnessbroker.de, www.qitnessbroker.de, www.fitnessbroker.de, www.itnessbroker.de, www.faitnessbroker.de, www.aitnessbroker.de, www.fyitnessbroker.de, www.yitnessbroker.de, www.ftitnessbroker.de, www.titnessbroker.de, www.fgitnessbroker.de, www.gitnessbroker.de, www.fbitnessbroker.de, www.bitnessbroker.de, www.fwitnessbroker.de, www.witnessbroker.de, www.fsitnessbroker.de, www.sitnessbroker.de, www.fditnessbroker.de, www.ditnessbroker.de, www.fritnessbroker.de, www.ritnessbroker.de, www.f3itnessbroker.de, www.3itnessbroker.de, www.f4itnessbroker.de, www.4itnessbroker.de, www.ftnessbroker.de, www.firtnessbroker.de, www.frtnessbroker.de, www.fiftnessbroker.de, www.fftnessbroker.de, www.fivtnessbroker.de, www.fvtnessbroker.de, www.fiktnessbroker.de, www.fktnessbroker.de, www.fi,tnessbroker.de, www.f,tnessbroker.de, www.fibtnessbroker.de, www.fbtnessbroker.de, www.figtnessbroker.de, www.fgtnessbroker.de, www.fittnessbroker.de, www.fttnessbroker.de, www.fiytnessbroker.de, www.fytnessbroker.de, www.fiutnessbroker.de, www.futnessbroker.de, www.fijtnessbroker.de, www.fjtnessbroker.de, www.fimtnessbroker.de, www.fmtnessbroker.de, www.fintnessbroker.de, www.fntnessbroker.de, www.finessbroker.de, www.fitqnessbroker.de, www.fiqnessbroker.de, www.fitanessbroker.de, www.fianessbroker.de, www.fit nessbroker.de, www.fi nessbroker.de, www.fitwnessbroker.de, www.fiwnessbroker.de, www.fitenessbroker.de, www.fienessbroker.de, www.fitznessbroker.de, www.fiznessbroker.de, www.fitxnessbroker.de, www.fixnessbroker.de, www.fitcnessbroker.de, www.ficnessbroker.de, www.fitessbroker.de, www.fitnnessbroker.de, www.fitnessbroker.de, www.fitnhessbroker.de, www.fithessbroker.de, www.fitnjessbroker.de, www.fitjessbroker.de, www.fitnkessbroker.de, www.fitkessbroker.de, www.fitnlessbroker.de, www.fitlessbroker.de, www.fitn essbroker.de, www.fit essbroker.de, www.fitnssbroker.de, www.fitnexssbroker.de, www.fitnxssbroker.de, www.fitnesssbroker.de, www.fitnsssbroker.de, www.fitnewssbroker.de, www.fitnwssbroker.de, www.fitnerssbroker.de, www.fitnrssbroker.de, www.fitnefssbroker.de, www.fitnfssbroker.de, www.fitnevssbroker.de, www.fitnvssbroker.de, www.fitnecssbroker.de, www.fitncssbroker.de, www.fitneqssbroker.de, www.fitnqssbroker.de, www.fitneassbroker.de, www.fitnassbroker.de, www.fitneyssbroker.de, www.fitnyssbroker.de, www.fitnesbroker.de, www.fitnesesbroker.de, www.fitneesbroker.de, www.fitneswsbroker.de, www.fitnewsbroker.de, www.fitnesdsbroker.de, www.fitnedsbroker.de, www.fitnesxsbroker.de, www.fitnexsbroker.de, www.fitnesfsbroker.de, www.fitnefsbroker.de, www.fitnesgsbroker.de, www.fitnegsbroker.de, www.fitnestsbroker.de, www.fitnetsbroker.de, www.fitnesbroker.de, www.fitnessebroker.de, www.fitnesebroker.de, www.fitnesswbroker.de, www.fitneswbroker.de, www.fitnessdbroker.de, www.fitnesdbroker.de, www.fitnessxbroker.de, www.fitnesxbroker.de, www.fitnessfbroker.de, www.fitnesfbroker.de, www.fitnessgbroker.de, www.fitnesgbroker.de, www.fitnesstbroker.de, www.fitnestbroker.de, www.fitnessroker.de, www.fitnessbqroker.de, www.fitnessqroker.de, www.fitnessbwroker.de, www.fitnesswroker.de, www.fitnessbzroker.de, www.fitnesszroker.de, www.fitnessbxroker.de, www.fitnessxroker.de, www.fitnessbroker.de, www.fitnessroker.de, www.fitnessbsroker.de, www.fitnesssroker.de, www.fitnessbyroker.de, www.fitnessyroker.de, www.fitnessberoker.de, www.fitnesseroker.de, www.fitnessbdroker.de, www.fitnessdroker.de, www.fitnessbcroker.de, www.fitnesscroker.de, www.fitnessboker.de, www.fitnessbrioker.de, www.fitnessbioker.de, www.fitnessbrooker.de, www.fitnessbooker.de, www.fitnessbrloker.de, www.fitnessbloker.de, www.fitnessbrloker.de, www.fitnessbloker.de, www.fitnessbr.oker.de, www.fitnessb.oker.de,

Other websites we recently analyzed

  1. Top Quality LED Moving Head Beam Bar & LED Moving Head Supplier
    China Pro Stage Lighting Manufacturer is best LED Moving Head Beam Bar, LED Moving Head and LED Par Light supplier, we provide quality products & service from China.
    Dallas (United States) - 108.168.242.88
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, jQuery, Php
    Number of Javascript: 4
    Number of meta tags: 3
  2. secret-money
    Ashburn (United States) - 52.203.203.182
    Server software: Pepyaka/1.9.13
    Technology: CSS, Html, Html5, Javascript, Wix
    Number of Javascript: 2
    Number of meta tags: 5
  3. Baustelle
    Germany - 134.0.26.187
    Server software: Apache/2.4.20 (Unix) OpenSSL/1.0.1e mod_fcgid/2.3.9
    Technology: Html
  4. Perspolis Medical Center
    Germany - 78.47.80.79
    Server software: nginx
    Technology: CSS, Google Font API, Html, Html5, Php
    Number of Javascript: 8
    Number of meta tags: 2
  5. opends.us
    Road Town (Virgin Islands, British) - 208.91.197.160
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  6. servico.info - Diese Website steht zum Verkauf! - Informationen zum Thema servico.
    Diese Website steht zum Verkauf! servico.info ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf servico.info alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Cambridge (United States) - 72.52.4.90
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 3
    Number of meta tags: 4
  7. Roma Hotel
    RomaHotel.it - Guida turistica e Hotel di Roma. Oltre 1100 Hotel a Roma che puoi prenotare online. Servizio di assistenza e prenotazione Hotel a Roma: inoltre Mappa della Città di Roma, Cosa Vedere, Itinerari, Musei e Attrazioni Turistiche di Roma
    Arezzo (Italy) - 46.37.17.210
    Server software: Apache/2.2.15 (CentOS)
    Technology: Google Adsense, AJAX Libraries API, CSS, Html, Javascript, Php, Google +1 Button
    Number of Javascript: 6
    Number of meta tags: 4
  8. 35789.kim
    China - 124.16.31.156
    Server software: Tengine/1.4.2
    Technology: CloudFront, Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  9. calvarychapelmerrimackvalley.com at Directnic
    Cayman Islands - 74.117.222.18
    Server software: nginx/1.5.0
    Technology: Html, Javascript
    Number of Javascript: 1
  10. Massachusetts Society of Mayflower Descendants - HOME
    The Mission of the Massachusetts Society of Mayflower Descendants is to gather together to honor and perpetuate the memory of our Mayflower Ancestors and the ideals of American freedoms and democracy, which have evolved from The Mayflower Compact signed by the Pilgrim Fathers when they reached Cape Cod shores in November, 1620.
    Provo (United States) - 67.20.65.25
    Server software: nginx/1.10.1
    Technology: PayPal, CSS, Html, Javascript, Php, Joomla, Add This
    Number of Javascript: 15
    Number of meta tags: 5

Check Other Websites